PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00052201-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 581aa    MW: 64447.1 Da    PI: 4.5609
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00052201-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS224.26.3e-693575731219
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+av+++d++ a+++L++++++as +gd +q la yf+ +L arl++s+ +l+ +l+ s +s    +e l+a++lf  + P++k+
  PSME_00052201-RA 357 LRALLVHCAQAVATDDTRGANEILKQIRQHASAYGDGTQCLANYFADGLVARLSGSGGRLFTKLSRSLAS---AAEILKAYQLFIVAIPYVKI 446
                       5789*********************************************************999999998...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                        h+++Nq++l+ +e+++r+Hi+Df+i +G+QWp+L+q La+Rp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+++gvpfe+++ +a 
  PSME_00052201-RA 447 YHFLTNQTVLNVTEKSNRLHIVDFGILYGFQWPSLIQRLANRPGGPPMLRITGIDFPQPGfrAAERIEETGRRLADYAKSFGVPFEYHA-IAA 538
                       ***********************************************************9*9***************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvs 219
                       ++e+l++eeL+++++E+l+Vn++++  +llde+v 
  PSME_00052201-RA 539 EWENLDVEELSLRNDEVLVVNCMYRFNNLLDETVV 573
                       ******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.915331581IPR005202Transcription factor GRAS
PfamPF035142.2E-66357573IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MADEKTSIFY SNDINGVSNN IGSQQETAMP ATQFRGSLSS EKPITISEGE SEDTELYSDI  60
VLKYINDMLM DENMEEKNVI YQECSALQAT VKPFYDILGE NYPPQGLCNS NTVGENQKQS  120
LNYYEDDVQN KIEDSCWIGE FFNSQMQRGF ESTLSANLSA GYSSQYSFSS SGSSTVIDGL  180
PGSPIYELSL SEIFSESRQG LGVGEFEEAI QVVPKRNIGL GVENGWHFGA PKKESDPDPD  240
LQVGKREAAI GVPFQMNAAH SDDENEPKRQ KGPHRGDLDL EDRESNKLSA VYQDNVIRTE  300
SFDKVLLCNE NGRVFLDWKL ETLQNGVQKS VQSGSVKGLQ GSKTLGTKQG KREVVDLRAL  360
LVHCAQAVAT DDTRGANEIL KQIRQHASAY GDGTQCLANY FADGLVARLS GSGGRLFTKL  420
SRSLASAAEI LKAYQLFIVA IPYVKIYHFL TNQTVLNVTE KSNRLHIVDF GILYGFQWPS  480
LIQRLANRPG GPPMLRITGI DFPQPGFRAA ERIEETGRRL ADYAKSFGVP FEYHAIAAEW  540
ENLDVEELSL RNDEVLVVNC MYRFNNLLDE TVVLGALLIS C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-323615718218GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.12e-97SCARECROW-like 14